DPCstruct | MC782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 349 |
|---|---|
| Mean domain length (aa) | 111 ± 23 aa |
| Standard deviation of domain lengths | 22.92 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.27 |
| Pfam Score | 84.72 |
| Assigned Pfam label(s) | CL0304- CL0123- CL0104- PF06189- CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7WHM1 | 4-119 | LRLTLRQLQIFVAVARSGSTTAASAEIALSQSATSSAVNELERLLSLRLFDRAGKRLLLNDNGRALLPRALALLDGAAGIEQMSRDG… |
| A0A2T5WCH6 | 355-427 | IAERLRTFETVLQAQSFAEAATRLGTRASVVSTHIRDLENIVGAHLFNRTQTGAHPTAEAHRLWRSINSARKG |
| A0A518HN36 | 6-146 | None |
| A0A0B8P0L4 | 2-117 | None |
| A0A228QWC6 | 1-127 | None |
| A0A228Q0K4 | 19-144 | None |
| A0A0X8HEB9 | 3-113 | None |
| A0A7C2JU71 | 1-96 | None |
| A0A0B8P7J3 | 6-149 | None |
| A0A848A6E2 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.