DPCstruct | MC7819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 229 ± 44 aa |
| Standard deviation of domain lengths | 43.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 49.09 |
| Assigned Pfam label(s) | CL0248- PF06245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7Y7U3 | 41-250 | NDIVKMIKELNAVDMPIIAAPIEGLNKYLIIDGHHRWAALKELGASKIPSIVINYFDPNVKVYTWYPAISGDFQALIKEVEGRNIHV… |
| A0A7Y1XAW9 | 20-249 | SEADYSFDAADGSKHHMWKIEGDAAANICQQFRDELYITDGHHRLAAASHVAAKEGRLDPHLPAGLFSSGELHLRSFARCVVDPGIN… |
| A0A6L3AB22 | 11-236 | None |
| A0A2E5G635 | 149-473 | None |
| A0A2G6P4R3 | 640-888 | None |
| A0A348B6V3 | 7-164 | None |
| A0A366L2Y7 | 80-341 | None |
| A0A3E0NUA7 | 202-502 | None |
| A0A534NXG8 | 49-300 | None |
| A0A521U0M3 | 296-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.