DPCstruct | MC7813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0GZK7 | 90-177 | VPNVYGMPIDKARKALADKGWKPVRGGASPEPRQAALVRRGITEAESCAGTGLAYCDFGYAGPAGRLTLTTVGEKDLPTVSDYDVKCR |
| A0A1W1BRL0 | 99-199 | KKHKSLRQGMPYSEARELILDSGWQGKNQRWQDIPQSGEINEIYYDNGWREIEDCSGTGMAYCRFEFTNIKNETLVVITEGECIKTS… |
| A0A2S6CV71 | 38-143 | None |
| A0A849RVD4 | 30-128 | None |
| A0A431KD65 | 10-120 | None |
| A0A286DDT3 | 11-127 | None |
| A0A2E9J3K5 | 3-93 | None |
| K9PXQ2 | 75-186 | None |
| A0A2D2LS43 | 13-128 | None |
| A0A1Q9BYB3 | 489-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.