DPCstruct | MC7811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 180 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2G5X1 | 69-231 | HTNTRFEHALLRETVLKQTDTGVRPQQSQTLASVGLACQTVTDVPACARLLASTVATTSLFAGSNPLQVRYLVLQSGANVRPIATRS… |
| A0A1W1BM37 | 4-186 | YDRASDFNLEEGVEYLEIRANVVYPWKKSHRVLFSTDKTYMSKMSQTLQETLNALAPIDNRENNLYLEHKRNSSSCRIVYNAVIVTN… |
| A6QBW1 | 28-225 | None |
| A6QBW4 | 21-188 | None |
| A6QBW0 | 3-207 | None |
| F8CGH0 | 3-169 | None |
| A0A1W1C8G8 | 47-225 | None |
| A0A1X9Z7F3 | 12-178 | None |
| A0A6S6U6R1 | 152-360 | None |
| A0A7D7LP74 | 15-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.