DPCstruct | MC781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 182 |
|---|---|
| Mean domain length (aa) | 219 ± 38 aa |
| Standard deviation of domain lengths | 38.35 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9I9Q1 | 1-135 | MQSNVSVHGMAVAPHHLASQSALSVLRDGGSAIEAMVAAAATIAVVYPHMNGLGGDGFWLIVPPGGEPIAIDASGAAGSLAMLAAYG… |
| W7W9Z5 | 7-260 | RAGYGSQRLPLFARNVVATSHPLAAQAGLRMLAAGGNAVDAAVATAAVMTIVEPCSNGLGSDAFCILWDGQALHGLNASGRAPQAWT… |
| A0A834Y5N1 | 3-164 | None |
| A0A7R9KZ75 | 57-310 | None |
| A0A453DZR8 | 64-265 | None |
| A0A0D8XVI6 | 41-212 | None |
| A0A0B8PJ57 | 4-185 | None |
| A0A6A7G230 | 91-340 | None |
| A0A226ETM2 | 47-287 | None |
| A0A813XUN0 | 55-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.