DPCstruct | MC7807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 220 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12009 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177W7E2 | 11-215 | ILDMHIRQQQVSSFVKSVLKHIIPNDIWGDDSNRDAFMAVVVQLVSLRRYEVLSLQNIGNGIKISKMAWLTSGIKPALHLSTCEAEK… |
| A0A834QA19 | 414-626 | GRPAEAPEGSADPGHLVELLDQHSSPWQVYAFLRACLCRLVPAGLWGSRHNQRRFLRNVKRFISLGKHARLSRRELTWKMKVRDCAW… |
| A0A0N0RSV1 | 2-191 | None |
| A0A445JF71 | 137-387 | None |
| H2QQL0 | 420-648 | None |
| A0A2X0MF67 | 562-796 | None |
| A0A2W1F9P1 | 446-665 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.