DPCstruct | MC7806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 18 aa |
| Standard deviation of domain lengths | 17.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7M8G7 | 1-127 | MNPSLRLGEDGINAVLLTLHSIRDRALTCRTCILALHMELTRLLEAQRAFRQLSYFDIRRRSCLTLQIARLTVGLPIALERALQRRQ… |
| A0A433PR50 | 2-159 | DGDFETIRTFIRALNEMNPNLNFGEEVIDTIEVAFRKLREVFLSTHKYFKLVRFELMRLYELQHELRQLSYFDILGRLRLTMTIARV… |
| A0A4Y9Y203 | 564-728 | None |
| A0A409VGC6 | 486-624 | None |
| A0A2G8S805 | 55-180 | None |
| A0A4Y9YMH0 | 95-242 | None |
| A0A0L0VIY0 | 230-413 | None |
| A0A0L6UJJ5 | 156-326 | None |
| A0A0K6GBI2 | 284-426 | None |
| A0A0W0FEY3 | 179-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.