DPCstruct | MC7805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433PPF3 | 16-78 | MQEFVVRNDSPCGSTIGPMLSAKLGLRTIDVGNPQLSMHSIREVGGTDDVGHAIKLFEVGSFE |
| A0A0A9LJ28 | 59-122 | FVVRNDMGCGSTIGPILASGVGIQTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFDMFSDI |
| A0A0D2MF79 | 1-61 | None |
| A0A2I0WJJ6 | 3-67 | None |
| A0A0G4KHZ5 | 296-366 | None |
| A0A183M398 | 1-65 | None |
| A0A7S3LVR6 | 84-159 | None |
| A0A524K1K7 | 1-53 | None |
| A0A847CQW6 | 7-69 | None |
| G7ZJS0 | 34-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.