DPCstruct | MC7803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 64.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 59.23 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0123- PF17226- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5B5R9 | 77-242 | PWKSLTNIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYESSKPNPNQISTSNGKPGTVNGAVGSTFQPQNPLLGRACESCY… |
| A0A673H3J7 | 248-420 | DIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQLSVNSVKPGLVNGAGALPGSPGQPVGLGR… |
| A0A3L8SR25 | 77-252 | None |
| H3A8C9 | 136-314 | None |
| A0A3Q2SNU6 | 378-552 | None |
| A0A401RZD1 | 62-237 | None |
| A0A060XMC8 | 195-340 | None |
| A0A3P8V9F0 | 247-406 | None |
| A0A674P9X1 | 294-467 | None |
| A0A183AS62 | 6-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.