DPCstruct | MC7800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2T7J7 | 2-120 | TLQQMRHTKLWLAGEAGNWELAAYEIKELQEGFDDVVKFHPTHEGSPVAPKDAIPRMVTVPLSEVNAVVEKKDPQAFGQAYDALTKA… |
| A0A838BTD7 | 6-136 | QEQDAGRPTLGDLMLLTQLRHFKLWYAQKVGNWPLANYELQQFKTTIDRIVKLYPTASSIAQANLIHEKTDPAMQALQQAVSDRDGS… |
| A0A5B9WER2 | 24-181 | None |
| A0A535D5F3 | 9-140 | None |
| A0A431UZG2 | 12-176 | None |
| A0A0P7WKK9 | 26-156 | None |
| A0A3M1E9W5 | 382-509 | None |
| A0A1V5P4B7 | 42-172 | None |
| A0A7X5VHM8 | 10-140 | None |
| A0A1F4FAG0 | 62-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.