DPCstruct | MC78
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8Q5L5 | 20-105 | AFKLKANKAQFYGADWSLQVDRLNGITLEEAQAHALNNDSITYFFRVKDGATMVLEGHGTFNSGDTVFFAGNPWYGSAMNLADSYE |
| A0A841EY76 | 1-85 | MKPNVAEFEGAPWDNHIISTYSTTVEAAKKYAEEHSNITFFFYCREHMTFEPEPHRTFDPGTAVFFSGKPWYGTAPQCDAYEKNK |
| A0A6G3Z5E2 | 1-98 | None |
| A0A1Y6CZ97 | 1-88 | None |
| A0A845WXV2 | 121-212 | None |
| A0A1H8YDL8 | 7-84 | None |
| A0A7V9UIZ8 | 43-131 | None |
| A0A4Q9FPS0 | 354-436 | None |
| A0A1I2JA00 | 1-86 | None |
| A0A6N7ZZG2 | 248-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.