DPCstruct | MC7799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5Z342 | 139-243 | DSEVEGFMKNVKNAILKNDRQWVISHIKYPINVTLNQKRRAIKNQNQMSVNFSQIFHADFKKKIKEECICNMFTNYQGIMLGDGQIW… |
| A0A838BR98 | 180-286 | YRAQKFDPYEAYYGFRRVKAAFRSGDAELIARVTDYPLSLTGKIRRTLRNRDQVLAAKETILNAAVRDAVAKSTFESVFVRDKGMMV… |
| A0A3A9EWW3 | 217-311 | None |
| A0A7X6ZQ39 | 34-157 | None |
| A0A4R3YWU7 | 184-286 | None |
| A0A4R6WH75 | 2-125 | None |
| A0A1W6ZX21 | 2-97 | None |
| A0A2N2MDH0 | 211-317 | None |
| A0A3B8Q6T7 | 277-390 | None |
| R6YQS5 | 21-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.