DPCstruct | MC7798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 228 ± 34 aa |
| Standard deviation of domain lengths | 33.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838BR51 | 4-196 | VRIDGVEEDGSARGGPLLLYSMSVHSPDGEEKEPFCLSDPQGRRAGFVIPDGSGGFHFTCTSGAEGKCVRMGYRPWENRDGISSHDL… |
| A0A1L6LPZ5 | 8-245 | EITAIARDGSSFVLRIDAMKPGSPSGVILYDISYRDLGGTSFTPICGTDDGVPIPVIPLAGYWDDSSGTSTGGSHVDEPGAITLACR… |
| A0A521QZN5 | 3-174 | None |
| A0A7Y4JN27 | 9-238 | None |
| A0A1I1WJF3 | 191-421 | None |
| A0A1I1YQR1 | 63-291 | None |
| A0A1I2I9W4 | 3-198 | None |
| A0A538R2F3 | 34-287 | None |
| A0A1I3YGA5 | 345-556 | None |
| A0A7W1AIF4 | 202-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.