DPCstruct | MC7794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0MFN3 | 4-96 | PPATFSGYGLGLRREHYADFLEQVQPVDFVEVISENFMVDGGRPLDVLSRIRERHPVALHGVSMNIGGEGLDRDYLRRLRHLADRVD… |
| A0A536XL53 | 8-117 | RGPGSTGRSHPFVGVGLRSPHTPDVLTRRPKVDWFEVHPENYMHNPAELASIERVRANYPVSLHGVALSLGSAQPLDSDHLARLKTI… |
| A0A4Q6G5H4 | 5-95 | None |
| A0A7I8CMY9 | 24-106 | None |
| A0A2S3XPF4 | 2-97 | None |
| A0A1E5A536 | 14-119 | None |
| A0A517ZZL1 | 10-100 | None |
| A0A4Q4XDZ4 | 9-94 | None |
| A0A1F4JVZ9 | 1-94 | None |
| A0A812ZWV4 | 130-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.