DPCstruct | MC7791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 15.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517VXE8 | 37-186 | LFGGDKTNATPTTSTTPEIQFTDTPVKYKTAAIEDIQIGERLLGKNPIQDEVDDFVPEIIPSEWRLLHLTMHKANGKRLDMQFLRPL… |
| A0A517X9G2 | 28-173 | LIGGVDAEILPSAQAAMSPSISPPRVVTTPIQQMRPGMRVVGRNPLRIETEATIDPTPEGWRLVSVRMRKEDGSYFEAELLRSLSWI… |
| A0A5Q4GK88 | 252-417 | None |
| A0A518CTF5 | 242-400 | None |
| D5SVZ3 | 551-694 | None |
| A0A5Q3L2Z6 | 6-174 | None |
| A0A2E7KFQ5 | 33-186 | None |
| A0A3E0Q381 | 52-219 | None |
| A0A518CT71 | 171-305 | None |
| A0A2E7K9B0 | 20-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.