DPCstruct | MC7790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 185 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6PRV4 | 52-248 | WRPVVWGTMGYFFGQALSPDPIIYDPGTTVVYEGDTIYINGESAGNADEYRRETIALANPELEETPMPGPPELAEDASEEEIAAAND… |
| A0A3D3R3S1 | 30-223 | YAAHPGVWYVPGWPAGYAWSACTWNSMMAWLTLANSQPLYYDYGNNVVYQDNSVYVNNQDVGSAEEYTQQASQLASQGAAADVSNQK… |
| A0A5C5ZTC3 | 200-385 | None |
| A0A356EW50 | 108-302 | None |
| A0A7C7V1D8 | 92-262 | None |
| A0A518DC12 | 164-346 | None |
| A0A517TZH9 | 477-664 | None |
| A0A7W1TYX4 | 147-330 | None |
| A0A7V9A9I7 | 5-177 | None |
| A0A7W0FY62 | 296-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.