DPCstruct | MC7789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 11.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329T4C0 | 1-127 | MDQAIWKRLAGTFGDVATDLEKDWQRIWWIMSSICVTVLWVQRTRVVFHGEELTLERSAKELRSTILRQLRALTKRERSQPHTKIRG… |
| A0A484E2L3 | 125-262 | RTPPPLSRTLFQRLQQAFGNTVAEYIVQWKRIWWILCSVCISTLWIQRNRVVHERQQLSLLGSVQEFFSNGLRQLRALSARERRTLP… |
| M4BQQ3 | 182-316 | None |
| M4BML1 | 3-129 | None |
| M4BCV0 | 56-191 | None |
| M4B720 | 2-107 | None |
| A0A6A3NKR4 | 4-104 | None |
| G4ZZ11 | 98-233 | None |
| G4ZCK1 | 49-176 | None |
| A0A225WUR7 | 611-740 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.