DPCstruct | MC7787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3Q2L9 | 24-89 | MAALSQELTEPAEVSGDVQKGTLLEFHKRLAHLNYDSVERLAKEPSSGIYLTDHKWVNCLTCAEGK |
| A0A329T1B3 | 27-92 | DWEVSAADGVDISVVKGSLVGFHKRLGHLSYDAVERLAQDPISGIEITDHHRVNCLTCAQGKQSKN |
| A0A6A3U5K6 | 1-66 | None |
| F0WC33 | 23-93 | None |
| A0A6A3MF40 | 5-76 | None |
| F0WAA1 | 26-95 | None |
| A0A024GKL6 | 95-188 | None |
| A0A329RGF5 | 128-192 | None |
| A0A329RZC2 | 1-61 | None |
| A0A6A4EED9 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.