DPCstruct | MC7786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225VFM7 | 280-331 | KLSSRAWQLRIVPLIDIYANLYSDEGIPEDFVIPPEEPWPEEVWGVRLWLLV |
| A0A6A3GYP9 | 98-149 | KLSLRAWNKRVVPLLKTYAELHGEGEVPVDFVVPSDTPWEKKVTGVRLGLIV |
| A0A329RSV9 | 368-419 | None |
| A0A6A4EEW6 | 75-126 | None |
| A0A225WNG4 | 176-227 | None |
| A0A6A3M0N5 | 249-309 | None |
| G4Z373 | 158-209 | None |
| G4Z7V1 | 184-246 | None |
| A0A329T214 | 118-169 | None |
| A0A484EA41 | 71-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.