DPCstruct | MC7783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 147 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838W9I2 | 121-281 | AIAASDAGDEPGPPATLERVTLFGQVNVRELTLASEVIFTAPVIAQRRQAGCVRFSYVPAGSQTPRRFQCQPDLVLAGVTDPAEQAR… |
| A0A7W0R1R3 | 51-195 | SGTIDLEACTVVGKVHAVRMDVSNSILLAARSGPADPWPAPIRAERRQVGCIRFSFVPAGSRTPRRFRCAGGDPAHIPHFTSLRYGD… |
| M1YIV9 | 386-512 | None |
| A0A4D4N993 | 68-202 | None |
| A0A0A0E2H8 | 687-814 | None |
| A0A7K2NTS9 | 108-251 | None |
| A0A7V9Q6Y2 | 1-157 | None |
| A0A0B0EN54 | 241-411 | None |
| A0A831LMN7 | 132-279 | None |
| S4YB03 | 986-1131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.