DPCstruct | MC7781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2X2R4 | 26-168 | MDTTMATTRLEGAIQQQVIVAGGDPEVEAAARAILSALGPAVRQLAFDLAEQAANEVASQLPGYQIEVVLASGEPTLRVRSSDAGAS… |
| A0A7W0P0F1 | 1-125 | MTDPAIEAGGRAVLSSLHPALKEAALELVNQAADEVRAQLPGHRVEVMLSDGEPSLRITSDDMSAAAVEGDFDARITLRLPDSIKNV… |
| A0A2A9GRN2 | 1-181 | None |
| K0K5Z0 | 66-230 | None |
| A0A7R8P6T4 | 515-684 | None |
| A0A538IK48 | 1-115 | None |
| X8AT66 | 2-143 | None |
| A0A6A9URB2 | 11-176 | None |
| A0A4R4ZM52 | 1-166 | None |
| A0A0M8SPS0 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.