DPCstruct | MC7780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF01556- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0NWY0 | 1-73 | MLLLFGLTTRTKTLGSGTFHCQNERGDRNYVLLEARRWFTLFFIPVIPLKVLGELVQCSSCGVQYDSGVLEQA |
| A0A2D8SHJ9 | 4-79 | IFGYHPITKRIGPTEERECANCHNSKHWLLHKRTYFISVFFIPLIPTRQEYFVSCPVCNFREELIREDFKDMAPLA |
| A0A0F0CNT2 | 1-78 | None |
| A0A7V6X492 | 6-83 | None |
| A0A7W0PPM9 | 5-77 | None |
| A0A146IJ25 | 15-104 | None |
| A0A1B7N678 | 7-64 | None |
| A0A2N2YZC7 | 5-76 | None |
| A0A3A9VIS0 | 1-111 | None |
| A0A350RLT7 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.