DPCstruct | MC778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Standard deviation of domain lengths | 3.73 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5T1E9 | 28-120 | QQNSSLSQRFQEIVDIVETLASDCKGNTYDLLSLLRILETLHRQIRSDMFEPSLPDTRKNLYEVLRDIEETGGWPYIERMKLQKFLE… |
| A0A1J0ABN9 | 4-98 | PQLQAIQEAVRAVVQERQGDAVALLAVLRLLEFLHREIESGSFTVALPQTRQDLYDLLLDIETQGGWPYIYRRSLESLLVYIRKTET… |
| A0A354B110 | 2-83 | None |
| A0A0P7YVX3 | 44-127 | None |
| A0A2W4ZUX7 | 12-95 | None |
| A0A6N8FVQ2 | 4-91 | None |
| A0A3M9ZAD8 | 11-99 | None |
| A0A7X3YQS7 | 1-89 | None |
| Q2JJ91 | 1-87 | None |
| A0A0V7ZR61 | 10-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.