DPCstruct | MC7779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 247 ± 46 aa |
| Standard deviation of domain lengths | 45.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.93 |
| Pfam Score | 97.30 |
| Assigned Pfam label(s) | PF01493- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101E350 | 58-213 | KLLLDGDFSRVKWIGCRMTDGEIVVKGSVGANCGAYMAGGKIVIEGNADDWLGAEMKDGEIIVKGNAANLVGCAYYGDATGMSGGKI… |
| A0A7W0LQK8 | 356-641 | LTGNPRADAVDLLHLLQAPAEPGAVRHFVETHPMQRPRSDLGDQLLADAFRPLWDGQDVELAYPISTRDRAIGAALGGALALEFGED… |
| A0A7R9B6E6 | 306-553 | None |
| A0A7C2L3K6 | 3-238 | None |
| A0A497HUU5 | 2-226 | None |
| A0A2H5ZX15 | 123-389 | None |
| A0A2H3D9D1 | 48-258 | None |
| A0A2R7S2Y0 | 2-219 | None |
| A0A061RLG3 | 1-232 | None |
| A0A257STM8 | 138-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.