DPCstruct | MC7778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 154 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4LSN8 | 1-138 | MKYQLEYDKVLITNKDFVLEKTGEIISSVSMLIRFGKVFEGEPSEGLYTYFEEADSTLPGLLRISYDSETKEFGFYPHEILGDNYEV… |
| A0A3R6DUZ8 | 1-116 | MGYLILGYDFDCREFQYQGRTVQGLVFEVKTNEKISRRNRENITVELSQKNGFWVRLHQNAKGIKVEPYKSYAAVPCKDAPWQLEQI… |
| B1V6T6 | 4-162 | None |
| A0A6N3HD23 | 9-169 | None |
| A0A6G7JLC1 | 2-153 | None |
| A0A1Q8VJD1 | 111-242 | None |
| A0A1M6GVS6 | 4-148 | None |
| A0A1E9JS83 | 1-168 | None |
| A0A1L7RMY9 | 1-142 | None |
| A0A0M2B4C8 | 2-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.