DPCstruct | MC7777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 297 ± 36 aa |
| Standard deviation of domain lengths | 35.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7R847 | 4-320 | SELTIALFVVGIVFLVIIPVPPLVMDFLLIFNITLSIIILLTTMYVKDSLDFYVFPSILLVTTLIRLALNISSTRLILTHAYAGGVI… |
| A0A2X2BJI5 | 12-348 | GNWKSSQWQILAGPVLILLILSMMVLPLPPFLLDLLFTFNIALSIMVLLVAMFTRRTLDFAAFPTILLFTTLLRLSLNVASTRIILM… |
| A0A0U1HH72 | 20-331 | None |
| A0A090PD40 | 3-325 | None |
| A0A7T9DEX4 | 20-335 | None |
| A0A489FML9 | 9-316 | None |
| A0A521UCR6 | 18-305 | None |
| A0A5E8HHJ4 | 133-390 | None |
| A0A7G9FET8 | 6-251 | None |
| A0A6S6RVV9 | 2-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.