DPCstruct | MC7776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 2.09 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2BHH5 | 1-74 | MGLCFPVNAMYRPHNNKAMEFIQTRARCRSNKGMIDRRNLKFMVTELKKGKAIWFAPDQDFGLKGTTFSPFFFG |
| G9Z8F1 | 62-129 | GGRVMGLCRPMMATYRQHNSPLMEYVQTKGRLRSNKAMIDRRNLRGLVQALKSGEAVWFAPDQDYGPK |
| A0A3S4I0S3 | 3-73 | None |
| A0A376FB64 | 91-158 | None |
| A0A0H3L267 | 3-73 | None |
| A0A844WAU5 | 2-69 | None |
| A0A447NNV4 | 1-72 | None |
| A0A2U3N450 | 11-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.