DPCstruct | MC7774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559KCT0 | 1-113 | MLEIRSNGSKWYGQELDTIEDLMKVLSEYPLDATFEKYGNFVTEFKPAKGWRPENEKYKGCTSFFGNFHTYSHVFSIITDELELIDR… |
| A0A218N4U7 | 15-122 | TLILSNGSKWAGQDPDSIQTLLDVLGDNVLDPMFEQYHCYRPYPFEPMVRTGRNGEMFQPWLGAACFFGNFLTVSHVFNIITKDDGV… |
| A0A0F9PWG2 | 1-93 | None |
| A0A4P6GAL1 | 2-89 | None |
| V5F7R9 | 10-130 | None |
| A0A1G0KUJ0 | 23-111 | None |
| A0A1C6JAK3 | 1-109 | None |
| A0A179SIF1 | 2-86 | None |
| A0A5C1M8T1 | 1-99 | None |
| A0A3A6ETS1 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.