DPCstruct | MC7772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z1SXY1 | 6-87 | IIRFQLLVHQLLKVHYGITLSDTGLSDDAEVSRMIELGISPVSAVNRLVDKYHLEKLNASCYLPASPYVSDTDALHAQAQLS |
| A0A5I0NX01 | 9-83 | LLQWQELVNKLFIKYYGIDINDTAFCEANYMKRYWTDCVRPYQAVNEWAYKYDLHRLDSVDTPLSEVNELSVNQY |
| A0A0B6F7I6 | 6-90 | None |
| W0BTP7 | 1-86 | None |
| A0A156MZ97 | 22-103 | None |
| A0A0T9XW37 | 50-142 | None |
| A0A1H9NW22 | 1-92 | None |
| A0A829LKF9 | 1-77 | None |
| A0A7V8ILL6 | 13-96 | None |
| A0A5U0W6C3 | 12-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.