DPCstruct | MC7771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Standard deviation of domain lengths | 19.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | PF14267- PF12008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S9NAU0 | 695-807 | SGTAPDEVNEKIKVYCKGKNIEGVGFYLGKRIGFEIIPGSTVKISNKAYGAAQKKREELFENGTIKKLTETKGEFIKSYICNTPSQA… |
| A0A380K3C4 | 2-72 | VEITDGKAIPESIRELRQELQEKGIIENGILKESQFFNSPSYAASFVLGINTNGRTDWKDSNGCTLKEIEE |
| A0A1I1YUV6 | 4-126 | None |
| A0A494RT61 | 173-312 | None |
| A0A1Q6MKS6 | 298-396 | None |
| A0A4R7KP21 | 382-504 | None |
| A0A416UAC6 | 290-389 | None |
| R5YRD8 | 3-98 | None |
| A0A1H6H3J4 | 785-908 | None |
| A0A543V9Y0 | 289-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.