DPCstruct | MC777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 14.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846D1T3 | 1-85 | KIDLNNTHVRKFRHYRGFYPNLASKIIQEGKIHPYKSVEDVLKIPGLSERQKKLLQAQIDEGTFTATPRSEVYNAGDDRYNPGVY |
| A0A1J0AAL3 | 10-124 | WLGVAVVLWLGLSQPVWATAKVERSGLNQVDAKLASPFGKQIDLNNTNVSAFSKYRGMYPTIAKVVVANAPYEQVEDVLKISGLTPQ… |
| A0A7S1GMM8 | 10-93 | None |
| A0A812XT93 | 91-182 | None |
| A0A7S0BD49 | 33-148 | None |
| A0A0S3U1R8 | 10-129 | None |
| A0A7R9ZNI8 | 1-142 | None |
| A0A1Q9CH81 | 73-188 | None |
| C0HJG3 | 35-152 | None |
| W7TEW9 | 102-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.