DPCstruct | MC7769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 140 ± 2 aa |
| Standard deviation of domain lengths | 2.28 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484NIH2 | 1-146 | MIAATIAWDDALSWTYKKSIHKLQATICEVCTIVKHLVGRVSDTYLLNSTHIPDKTSWDRDVKHALHMINSDDSTLIKVVLARSSRV… |
| A0A2Z7AR53 | 219-357 | MVPQVELDEFEGCSMIAATVAWDNRLSTTYEQAVAALEATMWQLSPVLKLNNDATPAVLLDQTHVPNQISWDLAVNEALNLIRSNDS… |
| A0A453KNV8 | 29-168 | None |
| A0A2G3C9R4 | 167-306 | None |
| A0A835RAM3 | 214-353 | None |
| A0A7J8NHP7 | 1-140 | None |
| A0A816S6M3 | 224-362 | None |
| A0A446U8C1 | 453-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.