DPCstruct | MC7768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 9.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0RBZ3 | 63-143 | TEIFIPKGVCAKQINFAVEDGKLSYLNFTGGCDGNLKAVSALTEGMELEDIIRKLSGITCGKKSTSCPDQLCCALREYINE |
| A0A1G3G0Z7 | 3-83 | EFFPTATCAKKIMFSIEDNKLRNLHFFRGCDGNLKTLSKLLDGTDVDEVVEKLRGIQCGTRGTSCSDQLALAIIAAMESRR |
| A0A847QLM1 | 1-55 | None |
| A0A645IPJ6 | 6-88 | None |
| A0A1M6HW42 | 2-81 | None |
| A0A3C1CYV6 | 3-69 | None |
| A0A015V4F4 | 2-63 | None |
| A0A143X8X4 | 2-83 | None |
| A0A1I7FZ39 | 21-103 | None |
| A0A1C6J171 | 14-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.