DPCstruct | MC7767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 136 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7XCU4 | 323-458 | LDGRMIHTVEADLKKLEWYAEVPRESFGHAYQPLAKAGGHANDFAALWPDRAQQIQGLIELMRRWDTDKCELFATAYAAWNDLLIWG… |
| A0A1G3FXZ0 | 1-129 | MLRVAQDGGPGSRVDYEFLGDAAALRADLALALGDRMARFDDTFHQLADLSKPGIEAVATLYAAWNDFLMDGKSPSRGDLIREVLEN… |
| A0A6M1TIY7 | 46-188 | None |
| A0A2P1QVL9 | 550-691 | None |
| A0A6M8BQT8 | 382-517 | None |
| A0A522SYK7 | 625-767 | None |
| A0A5C2F3A4 | 181-316 | None |
| W7Q3Z8 | 145-282 | None |
| A0A433KDJ5 | 328-446 | None |
| A0A503HK06 | 972-1107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.