DPCstruct | MC7765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IFN1 | 38-160 | FSDLNKTLYRCDQEERDETQGKFGVYNVPGYGPLVYAGLQGIVSLLADIRPNNDLGHPLCVNLRQGNWLIDYVWQRLKEDDGTKPLG… |
| A0A818PIC6 | 124-251 | VILIDIERVPYRSSIEERSNGKSFDAYSIPNYGKLTYCSLQGQISILDKIRFNNDLKHPFIIYFKQGNWLMDYISTRIKIHSNTKQL… |
| A0A3P8AVF1 | 874-1015 | None |
| A0A0S7FMN2 | 363-487 | None |
| A0A0R3S651 | 266-399 | None |
| A0A0R3XCR1 | 38-188 | None |
| A0A3P7E7H1 | 389-519 | None |
| A0A0C2MJT8 | 3-132 | None |
| A0A1U7LJZ3 | 538-661 | None |
| A0A821XF01 | 7-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.