DPCstruct | MC7762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 136 ± 27 aa |
| Standard deviation of domain lengths | 27.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818LS46 | 2-132 | VHFDHENKRVQLALRSHEILSTLMKPQDQNPADCVTLWHPEYADYKIAATPGKPYGHLPVHFNMVEANMRLRRQQGQQLLGKDEYVL… |
| A0A2R7X272 | 2-108 | NVKSLWRPEYASYMVEGTPGKPYGGLLAHINIVESSMKYRREEVEELLQEGERCLTLTSYPRLGCGMFTSPPSFPNPKDSASRSLFI… |
| A0A6V7U691 | 43-187 | None |
| A0A815XKQ8 | 267-435 | None |
| A0A182ESZ5 | 34-139 | None |
| A0A7C8R3J9 | 56-207 | None |
| A0A7R8ZGP7 | 121-230 | None |
| A0A139GTH9 | 170-274 | None |
| A0A183HQC2 | 1-95 | None |
| L8HFP6 | 56-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.