DPCstruct | MC776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7K6Y1 | 1-107 | MKCEYCKKREGEKYTRTGNGHCVVFYLCPECHKKLNNLGVDPYEAVLEMIERDGTECEVCGYTVDDFKDTFLLGCPKCYEEMRDVVS… |
| A0A357YZ87 | 1-119 | MLCQYCGKNPATTFIRTISDGKLAQVALCAECAQKLGCSNFFDGLGDSSGDVLHELFAGEEGRPDAVRCECCGASFFDIVRSGRVGC… |
| A0A496UR13 | 1-111 | None |
| A0A7V2YZY7 | 5-131 | None |
| A0A518BQJ8 | 1-127 | None |
| A0A7C6KJY3 | 1-133 | None |
| A0A2H0P1Y4 | 1-112 | None |
| A0A522P6T3 | 1-98 | None |
| A0A353GL96 | 5-130 | None |
| A0A832M946 | 47-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.