DPCstruct | MC7758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4XHT6 | 1-83 | MNSDTKTKSTNAKYVVMDEHTLGYLIDETPNVMGVLAGSVKRRGHNPMNGPATIVHGNTRLRPANEIDFEFFRVALPSDFNAD |
| A0A1G4UQU8 | 2-69 | NAYYVLNGHTLGYINPAQPNVFGILHASVLRGSTFGRLDWFTITAPGVDRLEPATLADFDAFRVCPKG |
| A0A060UVT8 | 1-82 | None |
| A0A3A5TAJ3 | 1-84 | None |
| A0A7K0PL80 | 1-90 | None |
| A0A250LLF1 | 1-82 | None |
| A0A2I1DIZ0 | 1-92 | None |
| A0A2R5F9U2 | 65-145 | None |
| A0A2N8QQ08 | 1-81 | None |
| A0A5M3Q1I7 | 74-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.