DPCstruct | MC7756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 5.82 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R4MD92 | 5-102 | LEEIQKYDAGADASIVDNMAKTYRLVLSKRDSAFVATSDPDELKTVRENFLKKKLGLTDSDDKLDAVIAEVAEEMKADRMKERLTFY… |
| A0A5E4P213 | 108-208 | SDHVADIKKYAKKPVDEAAVARLAKTYQLVLSKPDAKYVACSDKEELDRVRENFLKKKLKLESGDLDGAIKAVCTTMKASHSKSRLT… |
| A0A7C3Q6U4 | 259-357 | None |
| A0A853DFE2 | 62-164 | None |
| A0A7L4ZGP9 | 663-765 | None |
| A0A2N0I3D4 | 4-104 | None |
| A0A845WXV2 | 6-107 | None |
| A0A4Q3IAZ7 | 5-104 | None |
| A0A258J6I7 | 6-104 | None |
| A6Q954 | 122-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.