DPCstruct | MC7753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 404 ± 93 aa |
| Standard deviation of domain lengths | 92.55 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4NSG3 | 45-351 | RVSGITALLEAGLPPDLVMRLAGHSTIAMTMYYNKPSASALNAKLSAVMKKAGYDLDSVNLTRERLESISAFLVNSRPEEDRADLHL… |
| A0A6I3T0T8 | 17-308 | LRFLKNAEIRDASPLVVANDAAALAALDANEPSGWTIGDIGICPVGMGKCNVGGPSLTGETVKSAFAPVPGGPKNCVRCRFFITGPA… |
| A0A2T0W684 | 3-319 | None |
| A0A8B4RNV7 | 289-664 | None |
| A0A7Y4BI13 | 457-986 | None |
| A0A416F974 | 432-908 | None |
| A0A1Q9H6P3 | 3-315 | None |
| A0A7T4RF95 | 147-621 | None |
| A0A0Q0J606 | 35-358 | None |
| A0A7U3VVN9 | 266-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.