DPCstruct | MC7752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 179 ± 39 aa |
| Standard deviation of domain lengths | 38.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834NJ31 | 10-166 | QERALIVSLQMFSLILERGVSLLKTQLDCGEEPRLVVGEDMQVLLPAIKIWCDWMLCHSTVWNPPPSCTDYRVGPPGDAWSRLATMA… |
| M7BIW2 | 103-271 | QEQATALGLCMFALLVRRCTSLLRESVGAWPQEAEQAEEDDIKVSALPQDLKELLPSVKVWSDWMLGHSDTWNPPPTSLELPKQVSV… |
| A0A7R9LVT3 | 52-197 | None |
| A0A0R4IZ84 | 1077-1261 | None |
| A0A1Y3EP33 | 79-292 | None |
| A0A182Y4V1 | 2-157 | None |
| A0A7I4AD49 | 24-308 | None |
| A0A151I0W9 | 38-255 | None |
| A0A2R7WM64 | 38-209 | None |
| E2A0Y4 | 10-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.