DPCstruct | MC7751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HW94 | 2-115 | IVIGGWINWTFSGFVTTRVPFPLTLRFKPMLQRGIELASLDAAWVSSASWYFLNVFGLRAIYTLVLGEGNAADQSRMMEEQMSGPAM… |
| M7BEG2 | 6-115 | FVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYTLILGQDNAADQSRVMQEQMTGAAMAMPADTNKAFKTE… |
| A0A0L8VMC0 | 413-539 | None |
| A0A370TS68 | 127-258 | None |
| A0A090L5H1 | 173-288 | None |
| A0A4U5M6R0 | 63-176 | None |
| A0A0D2MG06 | 2-119 | None |
| A0A1V8SYR0 | 102-230 | None |
| A0A166CLF7 | 110-245 | None |
| A0A6A4K3S1 | 592-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.