DPCstruct | MC7749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7EYV2 | 406-526 | GRKVYSSATLLLRIANYSAHLSNHNFDNYSKLADLLHHLPDTKKPLLKAIVQEGYASCSAALQIAMNVADTAARAAATGIAMRRSSW… |
| M7B1D1 | 17-132 | ANHQAMLGLYDFNMLRSMAKFGDFLPEDPKKGFYVILEEGKAVVKAALQAASDTADSAARTMASAISMRRTSWLQLLGLLTEVQQLI… |
| M7BFJ4 | 795-945 | None |
| M7BIF6 | 6-105 | None |
| M7BIP4 | 315-435 | None |
| M7CCT3 | 133-284 | None |
| M7BQT3 | 3-116 | None |
| M7BX73 | 20-147 | None |
| M7C6C7 | 23-129 | None |
| M7BFG1 | 61-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.