DPCstruct | MC7748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12480 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226NHY2 | 7-114 | FKKIILSQKSITDDLRKLLNQGEYDLFASAPMFESRFVQINQRGELIDLHNRPACVTVGMCAASSPMPSGILLARKEPVSPLEIMEN… |
| M7ATS2 | 13-136 | GVAGNSDKGIVRRSPRPFPECISDFAFAGWIPIIGELQRLLGRGEYNPLQPTPLFESNFLQVTKRGELVDLHTPASLVTLGIAATSP… |
| F1PKZ9 | 27-126 | None |
| M0QW72 | 15-107 | None |
| H3A439 | 20-126 | None |
| H3AK30 | 6-115 | None |
| M7CIZ3 | 166-298 | None |
| A0A485NJ67 | 1-120 | None |
| A0A151P1C2 | 28-145 | None |
| A0A4X2M7E0 | 20-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.