DPCstruct | MC7747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.26 |
| Pfam Score | 95.23 |
| Assigned Pfam label(s) | CL0229- CL0541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7J102 | 128-257 | PGSYVFRLSCTKLGQWAIGYVTHDKQILQTIPQNKSLAQALLDGQREGFYLFPNGGGENPDLTLLLGETSEGLIQVTEEQYELYCEM… |
| A0A6J2R8I8 | 128-251 | PGSYIFRLSCTRMGQWAIGHVTSKGAIVQTIPQNTPLYEALVQGFMGGCYLYPDGRDVNPDLTNVFEPAQRGKVKVTEEQYELYCDI… |
| A0A834KL40 | 100-225 | None |
| G1PX47 | 185-306 | None |
| A0A267G141 | 39-166 | None |
| A0A556TQB0 | 279-363 | None |
| A0A0R3Q9N5 | 47-156 | None |
| A0A654H4Z0 | 61-177 | None |
| A0A368FFV5 | 164-288 | None |
| A0A7R9KP25 | 44-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.