DPCstruct | MC7745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6TT17 | 11-120 | VPKIASEAKGTDFCGDKNSCYIIRSDVGVYMRCKDIHAGQDIKIHRLSEACRWGDHYLATDSHFYIIKGDEYRRVTDLSKDEDAVVY… |
| A0A3N0XWS8 | 5-100 | IPKSKAKGTDFCGVNNYYYIIRSDLGYYMQSSNFNKGLDISIFSLHPACQNGDHYLGHEDGYFYIITGSSYRRVTDLTADSSAVAYS… |
| A0A498MIG7 | 5-100 | None |
| A0A6S7IF71 | 5-99 | None |
| A0A7J6CSA2 | 146-250 | None |
| A0A7J6D836 | 72-177 | None |
| A0A4D9DK31 | 33-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.