DPCstruct | MC7744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7H7L4 | 227-367 | QEEDPEDRRLQSEYLSDLMGSSPRPSILLSYLVTKPQQGNYNTYVSDRSGMKDIDRSDWDRWCEYILYKGLKKTAYARLSRSTITDT… |
| A0A821K030 | 1-156 | MGNDKDDLDRKLQAEKLRDIMHNSTNPLIFLGYVTSEPFSRDYRTLTSLAKDIDPTDRDRWCEYILYKNLIRVGYARITHAGLTDTE… |
| A0A1W5DDN9 | 824-943 | None |
| A0A1E3HUX3 | 665-785 | None |
| A0A820FBZ9 | 95-212 | None |
| A0A5E4BYD8 | 74-202 | None |
| A0A4Y9ZH02 | 63-194 | None |
| A0A6B0S5S0 | 549-672 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.