DPCstruct | MC7741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 17.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0025- PF04264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7HD58 | 42-116 | VSGEYKVDTDNAVVEWVGSKPAGKHNGTVKVKEGKVTVKDGVVTSGEFVLDMNTITVLDLTSEDGKENLEDHLKG |
| A0A535MVS9 | 1-87 | MGTWKFDPFHTQVEFSAKHLGMMTVRGHFNEVTATGEIHPDDPTRTKVEATINTASIRTHNEQRDKDLRSSNFLEIDKFPTMTFKST |
| A0A6N9YBU7 | 8-68 | None |
| A0A7V4J1C7 | 3-93 | None |
| A0A2E2YRC6 | 14-99 | None |
| U3UAK2 | 24-109 | None |
| A0A7W6GZD7 | 1-97 | None |
| A0A385SPP4 | 11-125 | None |
| A0A3R8ML92 | 19-119 | None |
| A0A4Z0IUR6 | 5-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.