DPCstruct | MC7740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8FSK3 | 105-150 | TVYECDSCGERSLGEQRCLECHTFMRRVGIGGHCPSCDESVAISEL |
| A0A535MSQ9 | 1-67 | MSRRPPHHLLFTADAASTVYECSACGERFLGERRCPECNLFARNLGLGSACPECDQIVLLDELLNLS |
| A0A535E0W9 | 23-71 | None |
| A0A535Y459 | 69-117 | None |
| A0A535XIC7 | 18-65 | None |
| A0A0D8FSI7 | 138-194 | None |
| A0A3D5DLK4 | 1-57 | None |
| A0A0D8HLN6 | 32-86 | None |
| A0A0D8HL90 | 51-106 | None |
| A0A2W6DTS2 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.