DPCstruct | MC7739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.49 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3MNK6 | 107-177 | PAFKDFSSRQLKHQSKEFSWIGSSWMCRKKRKHYQSFSRNGITISVFDFVHVMAEENKRLVAYLEDMYEDS |
| A0A2P6RE97 | 1-61 | MGPYTTGLMLLGSSSKRRKKRRHYQSFSRNGVIVSVHDFVFVLAEEGKRLVVYLEDMYEDS |
| A0A5J5B3S0 | 363-433 | None |
| A0A5J5TH63 | 123-197 | None |
| A0A5D1ZYM7 | 110-185 | None |
| A0A3L6DC95 | 71-145 | None |
| A0A804LWJ0 | 143-211 | None |
| A0A804LWJ3 | 136-211 | None |
| A0A0D2T2N5 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.